General Information

  • ID:  hor005279
  • Uniprot ID:  P18107
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Didelphis (genus), Didelphinae (subfamily), Didelphidae (family), Didelphimorphia (order), Metatheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APQEPVYPGDDATPEQMAKYAAELRRYINRLTRPRY
  • Length:  36
  • Propeptide:  APQEPVYPGDDATPEQMAKYAAELRRYINRLTRPRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P18107-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P18107-F1.pdbhor005279_AF2.pdbhor005279_ESM.pdb

Physical Information

Mass: 486222 Formula: C187H291N55O56S
Absent amino acids: CFHSW Common amino acids: APR
pI: 8.98 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -117.22 Boman Index: -11030
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 7831.67 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  2695899
  • Title:  Opossum insulin, glucagon and pancreatic polypeptide: amino acid sequences.